General Information

  • ID:  hor004761
  • Uniprot ID:  Q9LV88(74-109)
  • Protein name:  Elicitor peptide 2
  • Gene name:  PEP2
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Brassicaceae elicitor peptide family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0045087 innate immune response; GO:0098542 defense response to other organism
  • GO CC:  NA

Sequence Information

  • Sequence:  DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED
  • Length:  36(74-109)
  • Propeptide:  MEKLDKRREEETYLWIPVQFLDQALIAVLKCIGLLCQPAKKTAPSPVTFNQPEEQEEDYGVALKDDDVVVLLRDNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Elicitor of plant defense.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LV88-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004761_AF2.pdbhor004761_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 459684 Formula: C167H280N54O58
Absent amino acids: CFHLMW Common amino acids: K
pI: 10.49 Basic residues: 9
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: -177.22 Boman Index: -13547
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 35.28
Instability Index: 3903.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 42.57

Literature

  • PubMed ID:  20179141
  • Title:  PEPR2 Is a Second Receptor for the Pep1 and Pep2 Peptides and Contributes to Defense Responses in Arabidopsis